• Artykuły
  • Forum
  • Ciekawostki
  • Encyklopedia
  • Receptory jądrowe - od mechanizmu molekularnego po zdrowie i chorobę, Barcelona, Hiszpania

    26.08.2011. 17:49
    opublikowane przez: Redakcja Naukowy.pl

    W dniach 16 - 20 września 2011 r. w Barcelonie, Hiszpania, odbędzie się wydarzenie pt. "Receptory jądrowe - od mechanizmu molekularnego po zdrowie i chorobę".

    Sygnalizacja receptora jądrowego reguluje proliferację i różnicowanie wielu typów komórek oraz kieruje funkcjami fizjologicznymi wielu tkanek. Jego ekspresja występuje w znakomitej większości komórek, począwszy od komórek macierzystych i komórek prawidłowo zróżnicowanych po komórki nowotworowe i inne typy chorych komórek. Identyfikacja genu docelowego ma kluczowe znaczenie dla poznania funkcji receptorów jądrowych na poziomie molekularnym.

    Celem konferencji jest omówienie mechanizmów molekularnych sygnalizacji receptora jądrowego w zdrowiu i chorobie. Będzie to okazja do pogłębienia wiedzy nie tylko na temat najnowszych postępów w dziedzinie, ale również o dostępnych metodach leczenia farmakologicznego i terapii.

    Za: CORDIS

    Czy wiesz ĹĽe...? (beta)
    Anaplazja – brak zróżnicowania lub proces odróżnicowania się komórek, powstawanie z komórek zróżnicowanych nowych pokoleń komórek o coraz to mniejszym stopniu zróżnicowania albo też zatrzymanie różnicowania (dojrzewania) komórki wraz z zachowaną zdolnością do mnożenia się. Charakterystyczna dla nowotworów złośliwych. Obecnie uważa się, że raczej nowotwory powstają z komórek macierzystych niż że dochodzi do procesu odróżnicowania. Krew pępowinowa - stanowi źródło krwiotwórczych komórek macierzystych oraz komórek mezenchymy. Ta krew jest jedynym źródłem komórek macierzystych niewymagającym używania metod inwazyjnych u dawcy. Tkanki roślinne – zespoły komórek o podobnej budowie, określonych czynnościach i wspólnym pochodzeniu występujące u roślin. Niektóre tkanki tworzone są przez zespoły komórek jednego typu, są to tkanki jednorodne lub proste. Większość tkanek roślinnych składa się z komórek kilku typów, są to tkanki niejednorodne lub złożone.

    Pluripotencja (pluripotencjalność) jest zdolnością pojedynczej komórki do zróżnicowania się w dowolny typ komórek somatycznych poza komórkami trofoblastu, które w późniejszych stadiach rozwoju tworzą łożysko. Z pluripotencjalnych komórek macierzystych pochodzących z najwcześniejszego stadium zarodka – 5-dniowej blastocysty biorą początek komórki wszystkich tkanek i narządów. Zaledwie 30-35 tych komórek, z których składa się węzeł zarodkowy blastocysty "gromadzi" instrukcje dla 100 bilionów (10) komórek tworzących ludzki organizm. Terapia komórkowa - rozwijająca się w medycynie gałąź terapii, polegająca na wykorzystaniu ludzkich komórek do regeneracji uszkodzonych tkanek lub narządów pacjenta. Komórki te mogą pochodzić z tego samego pacjenta, lub od dawcy. Metoda ta różni się od przeszczepów tym, że korzysta się w niej nie z całych narządów lub tkanek, ale z wyizolowanych, oczyszczonych i czasem zmodyfikowanych komórek. Do terapii komórkowej często stosuje się komórki macierzyste lub progenitorowe, które posiadają wewnętrzny potencjał regeneracji uszkodzonych tkanek. Przykładowo, ostatnio pojawia się coraz więcej doniesień o skutecznym wykorzystaniu komórek macierzystych pochodzących ze szpiku kostnego do regeneracji mięśnia sercowego po zawale.

    Komórki iPS (ang. iPSC – induced pluripotent stem cells) – rodzaj pluripotencjalnych komórek macierzystych, które zostały sztucznie otrzymane z nie-pluripotentnych komórek (przeważnie komórek somatycznych dorosłego człowieka) przez wymuszenie ekspresji odpowiednich genów w tych komórkach. Rakowe komórki macierzyste (ang. Cancer stem cells, CSCs) - to inicjalne, niezróżnicowane komórki rakowe (obecne w guzach i nowotworach układu krwiotwórczego), mające możliwość przekształcania się we wszystkie rodzaje komórek tworzących masę nowotworową.
    Jedna z teorii wyjaśniających proces nowotworzenia zakłada, że rakowe komórki macierzyste są prekursorami innych komórek nowotworowych i odgrywają kluczową rolę w powstawaniu raka. Komórki te, w przeciwieństwie do innych komórek rakowych, są rakotwórcze (same w sobie mają zdolność do wywoływania raka). Podejrzewa się, że CSCs są przyczyną występowania przerzutów i nawrotów choroby nowotworowej.

    Terapia fotodynamiczna (PDT) – forma leczenia, w której wykorzystuje się nietoksyczne związki światłoczułe, które po ekspozycji na specyficzny rodzaj światła, stają się toksyczne dla komórek nowotworowych i innych chorych komórek. PDT wykazuje również zdolność do zabijania komórek mikroorganizmów, w tym bakterii, grzybów i wirusów. PDT jest powszechnie stosowana w leczeniu trądziku. Jest ona stosowana klinicznie do leczenia wielu schorzeń, w tym związanego z wiekiem zwyrodnienia plamki żółtej i nowotworów złośliwych. Jest uznanawana jako strategia leczenia, która jest zarówno mało inwazyjna jak i minimalnie toksyczna. Komórki satelitarne – komórki macierzyste mięśni szkieletowych. Powstają z mioblastów, które nie zlały się do roboczych komórek mięśniowych, lecz ściśle do nich przylegają. U dorosłego człowieka ich jądra stanowią ok. 5% jąder komórek mięśniowych. Uaktywniają się przy uszkodzeniu lub trenowaniu mięśnia, prowadząc do regeneracji lub przerostu komórek mięśniowych. W warunkach doświadczalnych udaje się je różnicować do innych komórek niż mięśniowe.

    Mastocytoza - choroba spowodowana patologiczną proliferacją komórek tucznych. Rozróżnia się mastocytozę skórną, kiedy mastocyty gromadzą się tylko w skórze, oraz mastocytozę układową, łączącą się z rozrostem komórek tucznych w jednym lub kilku organach, np. w szpiku.

    Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy Hyalophora cecropia. Peptydy te wyizolowano również od ssaków. Są to białka o ciężarze cząsteczkowym = 4203.4g/mol, zbudowane z 34-39 aminokwasów, posiadają dwie α-helisy. Wyróżniamy cekropiny: cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK) i cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL), cekropinę P1 (wyizolowana z jelita świń). Cekropiny są aktywne wobec bakterii Gram-dodatnich i Gram-ujemnych. Zarówno cekropina A, jak i cekropina B wykazują właściwości cytolityczne w stosunku do kilku różnych linii komórek nowotworowych, przy czym nie powodują niszczenia prawidłowych komórek fibroblastów, limfocytów i erytrocytów. Suttman i wsp. wykazali, że cekropiny A i B wykazują dużą toksyczność względem komórek raka pęcherza moczowego z niewielkim efektem toksycznym w stosunku do komórek prawidłowych fibroblastów. Badania Madera wykazały, że skojarzenie cekropiny A z 5-fluorouracylem przynosi dodatkowy efekt cytotoksyczny przeciwko komórkom ostrej białaczki limfatycznej i może być zastosowana w terapii przeciwnowotworowej.

    Retinopatia barwnikowa (łac. retinitis pigmentosa) – choroba rozpoczynająca się w okresie młodzieńczym, związana z odkładaniem się barwnika w siatkówce oka, z wtórnymi do tego procesu zaburzeniami krążenia w obrębie siatkówki i postępującym pogorszeniem wzroku, związanym ze zmianami zanikowymi siatkówki i utratą komórek siatkówki. Początkowo zmiany zanikowe dotyczą tylko fotoreceptorów i nabłonka barwnikowego siatkówki, a w późniejszych fazach choroby także komórek warstw wewnętrznych.

    Dodano: 26.08.2011. 17:49  


    Najnowsze